A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10017
Swiss-prot Accession number	P68273 (Sequence in FASTA format)
Description	Glucagon.
Source organism	Camelus dromedarius (Dromedary) (Arabian camel)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Tylopoda;Camelidae; Camelus.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis
Protein Length	29 Amino acids
Molecular weight	3483
References	1  PubMed abstract 4421675
Domain Name	Hormone_2
Hormone Name	Glucagon
Mature Hormone Sequence	HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Position of mature hormone in Pre-Hormone protein	29 Residues from position (1-29)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10725
Swiss-prot Accession number	Q7YRR6 (Sequence in FASTA format)
Description	Somatotropin precursor (Growth hormone).
Source organism	Camelus dromedarius (Dromedary) (Arabian camel)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Tylopoda;Camelidae; Camelus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues
Protein Length	216 Amino acids
Molecular weight	24485
References	1  PubMed abstract 15461431
Domain Name	Hormone_1
Hormone Name	Somatotropin
Mature Hormone Sequence	FPAMPLSSLFANAVLRAQHLHQLAADTYKEFERTYIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRAGQILRQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF
Position of mature hormone in Pre-Hormone protein	190 Residues from position (27-216)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10806
Swiss-prot Accession number	P01320 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Camelus dromedarius (Dromedary) (Arabian camel)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Tylopoda;Camelidae; Camelus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5694
References	1   Danho W.O.; "The isolation and characterization of insulin of camel (Camelusdromedarius)."; J. Fac. Med. Baghdad 14:16-28(1972).
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FANQHLCGSHLVEALYLVCGERGFFYTPKA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10807
Swiss-prot Accession number	P01320 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Camelus dromedarius (Dromedary) (Arabian camel)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Tylopoda;Camelidae; Camelus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5694
References	1   Danho W.O.; "The isolation and characterization of insulin of camel (Camelusdromedarius)."; J. Fac. Med. Baghdad 14:16-28(1972).
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCASVCSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	11008
Swiss-prot Accession number	P22393 (Sequence in FASTA format)
Description	Prolactin (PRL).
Source organism	Camelus dromedarius (Dromedary) (Arabian camel)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Tylopoda;Camelidae; Camelus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Prolactin acts primarily on the mammary gland by promoting lactation
Protein Length	199 Amino acids
Molecular weight	22971
References	1  PubMed abstract 2029533 2  PubMed abstract 2085952
Domain Name	Hormone_1
Hormone Name	Prolactin
Mature Hormone Sequence	LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFMTKAINSCHTSSLSTPEDKEQAQQIHHEDLLNLVLRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGVKENEIYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC
Position of mature hormone in Pre-Hormone protein	199 Residues from position (1-199)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated